General Information

  • ID:  hor000641
  • Uniprot ID:  O44314
  • Protein name:  Helicostatin-2a
  • Gene name:  NA
  • Organism:  Helicoverpa armigera (Cotton bollworm) (Heliothis armigera)
  • Family:  Allatostatin family
  • Source:  animal
  • Expression:  Highly expressed in the CNS and gut of larvae. Also expressed in the cells of the larval brain and ventral nerve cord and in endocrine cells of the midgut.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Helicoverpa (genus), Heliothinae (subfamily), Noctuidae (family), Noctuoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AYSYVSEYKRLPVYNFGL
  • Length:  18(62-79)
  • Propeptide:  MLYSSLPVCFLVLGAALCAPERMQNEAEPHDLQPHEAEPHSDHVAPLAKRSPHYDFGLGKRAYSYVSEYKRLPVYNFGLGKRSRPYSFGLGKRSVDEDQSNDEQQLTTSDLDQAALAELFDQYDDAEKRARPYSFGLGKRFADDETSEEKRARAYDFGLGKRLPMYNFGLGKRARSYNFGLGKRYSKFNFGLGKRERDMHRFSFGLGKRSGDDVSADDSDNYFDV
  • Signal peptide:  MLYSSLPVCFLVLGAALC
  • Modification:  T18 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May act as a neurotransmitter or neuromodulator.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O44314-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000641_AF2.pdbhor000641_ESM.pdb

Physical Information

Mass: 247285 Formula: C104H149N23O28
Absent amino acids: CDHIMQTW Common amino acids: Y
pI: 8.98 Basic residues: 2
Polar residues: 8 Hydrophobic residues: 6
Hydrophobicity: -20 Boman Index: -1763
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 81.11
Instability Index: 4711.67 Extinction Coefficient cystines: 5960
Absorbance 280nm: 350.59

Literature

  • PubMed ID:  9392829
  • Title:  Lepidopteran Peptides of the Allatostatin Superfamily